Friday, April 18, 2008

This is what we found from Neuclotide BLAST

Formating result: Z24WWEVE012

Gene: Mycoplasma pneumoniae adhesin protein (P30) gene

Organism: Mycoplasma pneumoniae

Accesion number: EF614306.1

PubMed: 18032594

Max score: 1524

Totral score: 2739

Query coverage: 100%

E value: 0.0

Max ident: 100%

LOCUS EF614306 825 bp DNA linear BCT 18-MAR-2008

DEFINITION Mycoplasma pneumoniae adhesin protein (P30) gene, complete cds.

ACCESSION EF614306

VERSION EF614306.1 GI:148729625

KEYWORDS .

SOURCE Mycoplasma pneumoniae

ORGANISM Mycoplasma pneumoniae

Bacteria; Firmicutes; Mollicutes; Mycoplasmataceae; Mycoplasma.

REFERENCE 1 (bases 1 to 825)

AUTHORS Varshney,A.K., Chaudhry,R., Kabra,S.K. and Malhotra,P.

TITLE Cloning, expression, and immunological characterization of the P30

protein of Mycoplasma pneumoniae

JOURNAL Clin. Vaccine Immunol. 15 (2), 215-220 (2008)

PUBMED 18032594

REFERENCE 2 (bases 1 to 825)

AUTHORS Varshney,A.K., Chaudhry,R., Malhotra,P. and Kabra,S.K.

TITLE Direct Submission

JOURNAL Submitted (17-MAY-2007) Microbiology, All India Institute of

Medical Sciences, Ansari Nagar, New Delhi 110029, India

FEATURES Location/Qualifiers

source 1..825

/organism="Mycoplasma pneumoniae"

/mol_type="genomic DNA"

/isolation_source="clinical sample"

/db_xref="taxon:2104"

gene 1..825

/gene="P30"

CDS 1..825

/gene="P30"

/codon_start=1

/transl_table=4

/product="adhesin protein"

/protein_id="ABR09215.1"

/db_xref="GI:148729626"

/translation="MKLPPRRKLKLFLLAWMLVLFSALIVLATLILVQHNNTELTEVK

SELSPLNVVLHAEEDTVQIQGKPITEQAWFIPTVAGCFGFSALAIILGLAIGLPIVKR

KEKRLSEEKERQEQLAEQLQRISAQQEEQQALEQQAAAEAHAEAEVEPAPQPVPVPPQ

PQVQINFGPRTGFPPQPGMAPRPGMPPHPGMAPRSGFPPQPGMAPRPGMPPHPGMAPR

PGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMQPPRPGMPPQPGFPPKR"

ORIGIN

1 atgaagttac cacctcgaag aaagcttaaa ctgtttttat tagcctgaat gctagtgctg

61 ttcagcgctt taatagtgct tgcaacctta attttggtac agcacaacaa taccgaactg

121 acagaagtta agagtgaatt gagtcccctt aacgttgttt tacacgcaga agaggataca

181 gtacaaattc agggcaagcc gattactgag caagcatggt ttattcctac agttgctggt

241 tgctttggtt ttagtgccct agccatcatc ttgggccttg ctataggact gccaattgtg

301 aagcgcaagg aaaaacgctt atcggaggaa aaggaacgcc aagaacagtt agcggaacag

361 ctacaacgca tttctgccca acaagaagag caacaagcgt tagaacaaca agcagctgct

421 gaagcccatg ctgaagcgga agttgaacca gcaccacaac cagtaccagt accacctcaa

481 ccccaagtcc aaattaactt cggtccccgt actggtttcc cacctcaacc cggtatggcg

541 cctcgtccag gtatgccgcc acaccccggt atggctccaa gatctggttt cccacctcaa

601 cccggtatgg cgcctcgtcc aggtatgccg ccacaccccg gtatggctcc aagacctggt

661 ttcccacctc aacccggtat ggcgcctcgt ccaggtatgc cgccacaccc cggtatggct

721 ccaagacctg gtttcccacc tcaacccggt atggcgcctc gtcccggaat gcaaccacca

781 cgtcctggca tgccacccca acccggtttt ccaccaaaac gctaa

2 comments:

sfc said...

Can some one explain the function of this gene that you had identify?

IcebErg@Evon said...

This gene (adhesin protein P30) associated with cell development of M.pneumonia. P30 mutants (II-3 and II-7) support adhesin P1's receptor-binding function by localizing P1 to the attachment organelles.The loss of mutants P30 accompanied by the inability to cytadhere, the failure to localize adhesin P1 to the attachment organelle, an altered morphology, and avirulence.